Antibodies

Jump to Filters
View as table Download
GRK2 Rabbit Polyclonal Antibody
TA326201

USD 380.00

4 Weeks

Rabbit polyclonal GRK2 (Ab-86) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human ADRBK1.
GRK2 Rabbit Polyclonal Antibody
TA340022

USD 539.00

5 Days

Rabbit Polyclonal Anti-ADRBK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADRBK1 antibody: synthetic peptide directed towards the N terminal of human ADRBK1. Synthetic peptide located within the following region: PEPSIRSVMQKYLEDRGEVTFEKIFSQKLGYLLFRDFCLNHLEEARPLVE
GRK2 Rabbit Polyclonal Antibody
TA326219

USD 380.00

In Stock

Rabbit polyclonal ARBK1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ARBK1.
GRK2 Rabbit Polyclonal Antibody
TA327129

USD 450.00

3 Weeks

ADRBK1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ADRBK1
GRK2 Rabbit Polyclonal Antibody
TA340023

USD 539.00

5 Days

Rabbit Polyclonal Anti-ADRBK1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ADRBK1 antibody: synthetic peptide directed towards the C terminal of human ADRBK1. Synthetic peptide located within the following region: ILQCDSDPELVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPL