Antibodies

Jump to Filters
View as table Download
RAD21 Rabbit Polyclonal Antibody
TA312306

USD 380.00

In Stock

Rabbit polyclonal anti-RAD21 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RAD21.
RAD21 Rabbit Polyclonal Antibody
TA345136

USD 539.00

5 Days

Rabbit Polyclonal Anti-RAD21 Antibody - C-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Rad21 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: FSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEFEN
RAD21 Rabbit Polyclonal Antibody
TA345137

USD 539.00

5 Days

Rabbit Polyclonal Anti-RAD21 Antibody - N-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Rad21 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: EDDDMLVSTSASNLLLEPEQSTSNLNEKINHLEYEDQYKDDNFGEGNDGG