Rabbit Polyclonal Anti-ORC6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ORC6 antibody is: synthetic peptide directed towards the N-terminal region of Human ORC6. Synthetic peptide located within the following region: KAEEYLRLSRVKCVGLSARTTETSSAVMCLDLAASWMKCPLDRAYLIKLS |
Rabbit Polyclonal Anti-ORC6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ORC6 antibody: synthetic peptide directed towards the C terminal of human ORC6. Synthetic peptide located within the following region: VEAPAKEMEKVEEMPHKPQKDEDLTQDYEEWKRKILENAASAQKATAE |
Germany
Japan
United Kingdom
China