Antibodies

View as table Download

Rabbit Polyclonal TGF beta induced factor 2 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit polyclonal TGIF2 Antibody (C-term)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TGIF2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 171-199 amino acids from the C-terminal region of human TGIF2.

Rabbit polyclonal antibody to TGF beta induced factor 2 (TGFB-induced factor homeobox 2)

Applications WB
Reactivities Human (Predicted: Rat, Bovine, Rhesus Monkey, Mouse)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 161 and 237 of TGF beta induced factor 2

Rabbit Polyclonal Anti-Tgif2 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Tgif2 Antibody is: synthetic peptide directed towards the N-terminal region of RAT Tgif2. Synthetic peptide located within the following region: SDSDLGEDEGLLSLTGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEK