Antibodies

View as table Download

Rabbit polyclonal MBD2 Antibody (Center)

Applications IF, WB
Reactivities Human (Predicted: Mouse)
Conjugation Unconjugated
Immunogen This MBD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 250-279 amino acids from the Central region of human MBD2.

Rabbit Polyclonal MBD2 Antibody

Applications ELISA, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MBD2 antibody: mouse MBD2 (methyl-CpG binding domain protein 2), using a KLH-conjugated synthetic peptide containing an amino acid sequence from the central part of the protein

Rabbit Polyclonal Anti-MBD2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MBD2 antibody: synthetic peptide directed towards the N terminal of human MBD2. Synthetic peptide located within the following region: RAHPGGGRCCPEQEEGESAAGGSGAGGDSAIEQGGQGSALAPSPVSGVRR

Rabbit Polyclonal Anti-MBD2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MBD2 antibody: synthetic peptide directed towards the middle region of human MBD2. Synthetic peptide located within the following region: DCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNT

MBD2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human MBD2