Rabbit Polyclonal Anti-ATOH1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATOH1 antibody: synthetic peptide directed towards the middle region of human ATOH1. Synthetic peptide located within the following region: QLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRS |
Rabbit Polyclonal Antibody against ATOH1 (C-term)
| Applications | WB |
| Reactivities | Human (Predicted: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | This MATH1/HATH1/ATOH1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 323-354 amino acids from the C-terminal region of human MATH1/HATH1/ATOH1. |
Rabbit Polyclonal Antibody against ATOH1 (N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MATH1/HATH1/ATOH1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 78-109 amino acids from the N-terminal region of human MATH1/HATH1/ATOH1. |
Germany
Japan
United Kingdom
China
