Antibodies

View as table Download

Anti-NFE2L2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human nuclear factor (erythroid-derived 2)-like 2

Rabbit polyclonal anti-NRF2 / NFE2L2 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human NRF2.

Rabbit Polyclonal Nrf2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Nrf2

NFE2L2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NFE2L2

Rabbit Polyclonal Anti-Nfe2l2 Antibody

Applications WB
Reactivities Rat, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Nfe2l2 antibody is: synthetic peptide directed towards the N-terminal region of Rat Nfe2l2. Synthetic peptide located within the following region: DLIDILWRQDIDLGVSREVFDFSQRQKDYELEKQKKLEKERQEQLQKEQE

Rabbit Polyclonal Anti-Nrf2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Nrf2 Antibody: A synthesized peptide derived from human Nrf2