Antibodies

Jump to Filters
View as table Download
IL1 beta (IL1B) Rabbit Polyclonal Antibody
TA336742

USD 550.00

2 Weeks

Rabbit Polyclonal IL-1 beta/IL-1F2 Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to a C-terminal portion of the human IL 1 beta protein (between amino acids 100-200) [UniProt P01584]
RANTES (CCL5) Rabbit Polyclonal Antibody
AP20618PU-N

USD 445.00

3 Weeks

RANTES (CCL5) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 50-100 of Human RANTES.
IL1 beta (IL1B) Rabbit Polyclonal Antibody
AP20628PU-N

USD 465.00

3 Weeks

IL1 beta (IL1B) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 131-180 of Human IL-1 Beta
Macrophage Inflammatory Protein 1 beta (CCL4) Rabbit Polyclonal Antibody
TA319702

USD 570.00

5 Days

Rabbit Polyclonal CCL4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal CCL4 antibody was raised against a 15 amino acid peptide near the center of human CCL4.
IL33 Rabbit Polyclonal Antibody
TA306448

USD 570.00

2 Weeks

Rabbit Polyclonal IL-33 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IL-33 antibody was raised against a 19 amino acid peptide from near the center of human IL-33.
Interferon beta (IFNB1) Rabbit Polyclonal Antibody
AP05706PU-N

USD 590.00

5 Days

Interferon beta (IFNB1) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A 17 amino acid peptide located near the centre of human Interferon beta.
RANTES (CCL5) Rabbit Polyclonal Antibody
TA342306

USD 485.00

5 Days

Rabbit Polyclonal Anti-CCL5 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CCL5 antibody: synthetic peptide directed towards the middle region of mouse CCL5. Synthetic peptide located within the following region: YGSDTTPCCFAYLSLELPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCAN
IL1 beta (IL1B) Rabbit Polyclonal Antibody
TA347865

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Interleukin 1β Antibody

Applications WB
Reactivities Mouse, Rat, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Interleukin 1β Antibody: A synthesized peptide derived from human Interleukin 1β