Antibodies

Jump to Filters
View as table Download
DUSP8 Rabbit Polyclonal Antibody
TA322744

USD 380.00

In Stock

Anti-DUSP8 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2-14 amino acids of Human dual specificity phosphatase 8
DUSP8 Rabbit Polyclonal Antibody
TA340054

USD 539.00

5 Days

Rabbit Polyclonal Anti-DUSP8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DUSP8 antibody: synthetic peptide directed towards the middle region of human DUSP8. Synthetic peptide located within the following region: PAPPTPPATSALQQGLRGLHLSSDRLQDTNRLKRSFSLDIKSAYAPSRRP