Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CYP11A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP11A1 antibody: synthetic peptide directed towards the middle region of human CYP11A1. Synthetic peptide located within the following region: LRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQW |
Rabbit polyclonal CYP27B1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CYP27B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 482-508 amino acids from the C-terminal region of human CYP27B1. |
Rabbit polyclonal CYP1A2 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CYP1A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 255-282 amino acids from the Central region of human CYP1A2. |
Rabbit polyclonal CYP3A5 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CYP3A5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 476-502 amino acids from the C-terminal region of human CYP3A5. |
Rabbit Polyclonal Anti-CYP11B1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP11B1 antibody: synthetic peptide directed towards the C terminal of human CYP11B1. Synthetic peptide located within the following region: ARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGL |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Human
Applications
- WB
Antibody Hosts
- Rabbit
Families
- P450
Pathways
- Metabolic pathways
Filter by
Target Symbol
- CYTOCHROME P450 2B6 (8)
- CYTOCHROME P450 3A4 (8)
- CYP2A7 (5)
- CYTOCHROME P450 2E1 (5)
- TBXAS1 (5)
- CYP11A1 (4)
- CYP27A1 (4)
- CYP2U1 (4)
- CYTOCHROME P450 2A6 (4)
- CYTOCHROME P450 2J2 (4)
- AROMATASE (3)
- CYP11B1 (3)
- CYP21A2 (3)
- CYP27B1 (3)
- CYP2C18 (3)
- CYP3A7 (3)
- CYP8B1 (3)
- CYTOCHROME P450 17A1 (3)
- CYTOCHROME P450 3A5 (3)
- CYTOCHROME P450 4A (3)
- PTGIS (3)
- CYP4A22 (2)
- CYP4F3 (2)
- CYP7A1 (2)
- CYTOCHROME P450 1A2 (2)
- P4HA1 (2)
- CYP4F2 (1)
- CYP51A1 (1)
- CYTOCHROME P450 2C8 (1)
- CYTOCHROME P450 2C9 (1)