Rabbit Polyclonal Anti-Zinc-Activated Channel (ZAC) (extracellular)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide CNFELLHFPRDHSN, corresponding to amino acid residues 157-170 of human zinc-activated channel (ZAC).Extracellular, N-terminus. |
Rabbit Polyclonal Anti-LGICZ1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LGICZ1 antibody: synthetic peptide directed towards the N terminal of human LGICZ1. Synthetic peptide located within the following region: PSLFNVNLSKKVQESIQIPNNGSAPLLVDVRVFVSNVFNVDILRYTMSSM |
Germany
Japan
United Kingdom
China
