Germany
Japan
United Kingdom
China
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR-2D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit monoclonal anti-Sox2 Antibody, clone OR-4F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR-2D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Antibody against SOX2 - Embryonic Stem Cell Marker
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Sheep |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human SOX2 protein (within residues 1-100). [Swiss-Prot# P48431] |
Rabbit Polyclonal Antibody against OCT4 - Embryonic Stem Cell Marker
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human OCT4 protein sequence (between residues 100-200). |
Rabbit Polyclonal Anti-OTX2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OTX2 antibody: synthetic peptide directed towards the N terminal of human OTX2. Synthetic peptide located within the following region: PESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGT |
Rabbit polyclonal KLF4 Antibody (N-term C74)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This KLF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 69-101 amino acids from the N-terminal region of human KLF4. |
WNT3A Rabbit monoclonal antibody,clone OTIR4G6
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SOX10 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SOX10 Antibody: synthetic peptide directed towards the middle region of human SOX10. Synthetic peptide located within the following region: PGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPT |
Rabbit polyclonal anti-BDNF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with recombinant truncated human BDNF protein produced in E.coli. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- WB
Antibody Hosts
- Rabbit
Isotypes
- IgG
Families
- Induced pluripotent stem cells
Filter by
Target Symbol
- SOX2 (11)
- C-MYC (10)
- DNMT3B (8)
- FOXA2 (8)
- OCT4 (8)
- SOX1 (8)
- SOX9 (8)
- FGF4 (7)
- BDNF (6)
- KLF4 (6)
- GATA4 (5)
- PDX1 (5)
- WNT3A (5)
- BMP7 (4)
- OTX2 (4)
- PDGFC (4)
- SOX11 (4)
- SOX4 (4)
- SOX7 (4)
- TCF3 / E2A (4)
- BMP6 (3)
- EGF (3)
- NANOG (3)
- BMP2 (2)
- BMP4 (2)
- BMP8B (2)
- CD38 (2)
- KLF5 (2)
- NODAL (2)
- AXIN 2 (1)
- BMP5 (1)
- CD4 (1)
- DPPA2 (1)
- GDF3 (1)
- SOX10 (1)
- UTF1 (1)
Reactivities
Clonalities
Conjugates
Modifications
Assay Types
Pathways
- Pathways in cancer (30)
- MAPK signaling pathway (26)
- TGF-beta signaling pathway (26)
- Hedgehog signaling pathway (19)
- Wnt signaling pathway (16)
- Endometrial cancer (14)
- Melanoma (14)
- Regulation of actin cytoskeleton (14)
- Bladder cancer (13)
- Cytokine-cytokine receptor interaction (13)
- ErbB signaling pathway (13)
- Maturity onset diabetes of the young (13)
- Acute myeloid leukemia (12)
- Colorectal cancer (11)
- Basal cell carcinoma (10)
- Cell cycle (10)
- Chronic myeloid leukemia (10)
- Jak-STAT signaling pathway (10)
- Metabolic pathways (10)
- Small cell lung cancer (10)
- Thyroid cancer (10)
- Cysteine and methionine metabolism (8)
- Focal adhesion (7)
- Gap junction (7)
- Melanogenesis (7)
- Prostate cancer (7)
- Huntington's disease (6)
- Neurotrophin signaling pathway (6)
- Endocytosis (5)
- Hematopoietic cell lineage (5)
- Type II diabetes mellitus (5)
- Glioma (3)
- Non-small cell lung cancer (3)
- Pancreatic cancer (3)
- Calcium signaling pathway (2)
- Nicotinate and nicotinamide metabolism (2)
- Antigen processing and presentation (1)
- Cell adhesion molecules (CAMs) (1)
- Primary immunodeficiency (1)
- T cell receptor signaling pathway (1)