Germany
Japan
United Kingdom
China
Antibodies
View as table Download
CDC23 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human CDC23 (NP_004652.2). |
| Modifications | Unmodified |
Rabbit polyclonal anti-APC8 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human APC8. |
Rabbit Polyclonal Anti-IRF6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IRF6 Antibody: synthetic peptide directed towards the C terminal of human IRF6. Synthetic peptide located within the following region: FLSDLIAHQKGQIEKQPPFEIYLCFGEEWPDGKPLERKLILVQVIPVVAR |
CDC23 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CDC23 |
CDC23 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CDC23 |
Cdc23 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Cdc23 |
CDC23 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CDC23 |
Active filters
Target Symbol
- CDC23
Applications
- WB
Antibody Hosts
- Rabbit
Conjugates
- Unconjugated