Antibodies

View as table Download

Rabbit Polyclonal Anti-ST3GAL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ST3GAL3 antibody: synthetic peptide directed towards the C terminal of human ST3GAL3. Synthetic peptide located within the following region: GFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITD

Rabbit Polyclonal Anti-ST3GAL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ST3GAL3 antibody: synthetic peptide directed towards the N terminal of human ST3GAL3. Synthetic peptide located within the following region: MTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTK