Antibodies

Jump to Filters
View as table Download
FT1A (FUT6) (N-term) Rabbit Polyclonal Antibody
AP51740PU-N

USD 580.00

2 Weeks

FT1A (FUT6) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 19-49 amino acids from the N-terminal region of Human Fucosyltransferase 6
FT1A (FUT6) Rabbit Polyclonal Antibody
TA346667

USD 539.00

5 Days

Rabbit Polyclonal Anti-FUT6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FUT6 antibody: synthetic peptide directed towards the C terminal of human FUT6. Synthetic peptide located within the following region: YITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLAR