Antibodies

Jump to Filters
View as table Download
Glycerol 3 Phosphate Dehydrogenase (GPD1) Rabbit Polyclonal Antibody
TA332859

USD 365.00

2 Weeks

Rabbit anti-GPD1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GPD1
Glycerol 3 Phosphate Dehydrogenase (GPD1) Rabbit Polyclonal Antibody
TA346400

USD 539.00

5 Days

Rabbit Polyclonal Anti-GPD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPD1 antibody: synthetic peptide directed towards the N terminal of human GPD1. Synthetic peptide located within the following region: KANATGISLIKGVDEGPNGLKLISEVIGERLGIPMSVLMGANIASEVADE
Glycerol 3 Phosphate Dehydrogenase (GPD1) Rabbit Polyclonal Antibody
TA346401

USD 539.00

5 Days

Rabbit Polyclonal Anti-GPD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPD1 antibody: synthetic peptide directed towards the middle region of human GPD1. Synthetic peptide located within the following region: TFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGP