Rabbit Polyclonal Anti-ALAS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALAS2 antibody: synthetic peptide directed towards the C terminal of human ALAS2. Synthetic peptide located within the following region: VRLLKGEEGQALRRAHQRNVKHMRQLLMDRGLPVIPCPSHIIPIRVGNAA |
Rabbit Polyclonal Anti-SARDH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SARDH antibody is: synthetic peptide directed towards the C-terminal region of Human SARDH. Synthetic peptide located within the following region: SLSIEKGYRHWHADLRPDDSPLEAGLAFTCKLKSPVPFLGREALEQQRAA |
Germany
Japan
United Kingdom
China