Antibodies

Jump to Filters
View as table Download
ELOC Rabbit Polyclonal Antibody
TA350487

USD 380.00

In Stock

Rabbit Polyclonal Anti-TCEB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
ELOC Rabbit Polyclonal Antibody [Clone ID: Poly6131]
TA328011

USD 320.00

In Stock

Rabbit Polyclonal anti-Elongin C Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen Recombinant full-length
ELOC Rabbit Polyclonal Antibody
TA330158

USD 485.00

5 Days

Rabbit Polyclonal Anti-TCEB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TCEB1 antibody: synthetic peptide directed towards the middle region of human TCEB1. Synthetic peptide located within the following region: AENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALE
ELOC Rabbit Polyclonal Antibody
TA330159

USD 539.00

5 Days

Rabbit Polyclonal Anti-TCEB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TCEB1 antibody: synthetic peptide directed towards the N terminal of human TCEB1. Synthetic peptide located within the following region: EHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRY