Rabbit Polyclonal Anti-DCTN1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DCTN1 |
Rabbit Polyclonal Anti-DCTN1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DCTN1 |
DCTN1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DCTN1 |
Rabbit polyclonal antibody to dynactin 1 (dynactin 1 (p150, glued homolog, Drosophila))
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Mouse, Rat, Bovine) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 1216 and 1278 of DCTN1 (Uniprot ID#Q14203) |
Rabbit Polyclonal Anti-Dctn1 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Dctn1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Dctn1. Synthetic peptide located within the following region: EANVRLSLLEKKLDSAAKDADERIEKVQTRLEETQTLLRKKEKEFEETMD |
Rabbit anti-DCTN1 Polyclonal Antibody
Applications | IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human DCTN1 |
DCTN1 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human DCTN1 |
DCTN1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human DCTN1 |