Antibodies

Jump to Filters
View as table Download
TGIF (TGIF1) (Center) Rabbit Polyclonal Antibody
AP54235PU-N

USD 580.00

2 Weeks

TGIF (TGIF1) (Center) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 215-245 amino acids from the Central region of human TGIF1
TGIF (TGIF1) (Center) Rabbit Polyclonal Antibody
AP54234PU-N

USD 580.00

2 Weeks

TGIF (TGIF1) (Center) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 152-182 amino acids from the Central region of human TGIF1
TGIF (TGIF1) Rabbit Polyclonal Antibody
TA339200

USD 539.00

5 Days

Rabbit Polyclonal Anti-TGIF1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TGIF1 antibody: synthetic peptide directed towards the C terminal of human TGIF1. Synthetic peptide located within the following region: GQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQSGLFNTPPPTPPDLN