Antibodies

Jump to Filters
View as table Download
HERC3 Rabbit Polyclonal Antibody
TA329871

USD 539.00

5 Days

Rabbit Polyclonal Anti-HERC3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HERC3 antibody is: synthetic peptide directed towards the middle region of Human HERC3. Synthetic peptide located within the following region: LHFPLALYKKLLNVKPGLEDLKELSPTEGRSLQELLDYPGEDVEETFCLN
HERC3 Rabbit Polyclonal Antibody
TA356323

USD 539.00

5 Days

HERC3 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HERC3