Antibodies

Jump to Filters
View as table Download
TANK Rabbit Polyclonal Antibody
TA306341

USD 570.00

In Stock

Rabbit Polyclonal TANK Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TANK antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human TANK.
TANK Rabbit Polyclonal Antibody
TA306342

USD 570.00

5 Days

Rabbit Polyclonal TANK Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TANK antibody was raised against a 14 amino acid peptide from near the amino terminus of human TANK.
TANK Rabbit Polyclonal Antibody
TA329131

USD 539.00

5 Days

Rabbit Polyclonal anti-TANK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TANK antibody is: synthetic peptide directed towards the N-terminal region of Human TANK. Synthetic peptide located within the following region: ILYSDATGRRGMDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQ
TANK Rabbit Polyclonal Antibody
TA343442

USD 539.00

5 Days

Rabbit Polyclonal Anti-TANK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TANK antibody: synthetic peptide directed towards the C terminal of human TANK. Synthetic peptide located within the following region: KPFPNQDSDSVVLSGTDSELHIPRVCEFCQAVFPPSITSRGDFLRHLNSH
TANK Rabbit Polyclonal Antibody
TA343443

USD 539.00

5 Days

Rabbit Polyclonal Anti-TANK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TANK antibody: synthetic peptide directed towards the N terminal of human TANK. Synthetic peptide located within the following region: DKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQ