Rabbit Polyclonal Anti-CARS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CARS antibody is: synthetic peptide directed towards the N-terminal region of Human CARS. Synthetic peptide located within the following region: ADSSGQQAPDYRSILSISDEAARAQALNEHLSTRSYVQGYSLSQADVDAF |
Rabbit Polyclonal Anti-CARS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CARS antibody: synthetic peptide directed towards the middle region of human CARS. Synthetic peptide located within the following region: QEQEAAKLAKMKIPPSEMFLSETDKYSKFDENGLPTHDMEGKELSKGQAK |
Germany
Japan
United Kingdom
China