Antibodies

Jump to Filters
View as table Download
Cyclophilin 40 (PPID) Rabbit Polyclonal Antibody
TA342238

USD 539.00

5 Days

Rabbit polyclonal Anti-PPID Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPID antibody: synthetic peptide directed towards the middle region of human PPID. Synthetic peptide located within the following region: AECGELKEGDDGGIFPKDGSGDSHPDFPEDADIDLKDVDKILLITEDLKN
Cyclophilin 40 (PPID) Rabbit Polyclonal Antibody
TA342237

USD 539.00

5 Days

Rabbit polyclonal Anti-PPID Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPID antibody: synthetic peptide directed towards the N terminal of human PPID. Synthetic peptide located within the following region: CPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSM