Antibodies

Jump to Filters
View as table Download
OR2F2 Rabbit Polyclonal Antibody
TA316113

USD 380.00

4 Weeks

Rabbit polyclonal anti-OR2F2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR2F2.
OR2F2 Rabbit Polyclonal Antibody
TA337490

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR2F2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR2F2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR2F2. Synthetic peptide located within the following region: PHSGPSVLQEKLISVFYAIVMPLLNPVIYSLRNKEVKGAWHKLLEKFSGL