Antibodies

View as table Download

CAMK2B rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal CaMK2- beta/ gamma/ delta (Thr287) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CaMK2- beta/ gamma/ delta around the phosphorylation site of Threonine 287
Modifications Phospho-specific

Rabbit Polyclonal CaMK2-beta/gamma/delta Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CaMK2-beta/gamma/delta

Rabbit polyclonal CaMK2-beta/gamma/delta (Thr287) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CaMK2-β/?/d around the phosphorylation site of threonine 287 (Q-E-TP-V-E).
Modifications Phospho-specific

Rabbit Polyclonal Anti-CAMK2B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CAMK2B antibody: synthetic peptide directed towards the C terminal of human CAMK2B. Synthetic peptide located within the following region: NPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNV