Antibodies

Jump to Filters
View as table Download
GPR12 Rabbit Polyclonal Antibody
TA338158

USD 539.00

5 Days

Rabbit Polyclonal Anti-GPR12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR12 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR12. Synthetic peptide located within the following region: SICLGLLPVMGWNCLRDESTCSVVRPLTKNNAAILSVSFLFMFALMLQLY
GPR12 Rabbit Polyclonal Antibody
TA362142

USD 539.00

5 Days

GPR12 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GPR12