Rabbit Polyclonal Anti-HNF4G Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNF4G antibody: synthetic peptide directed towards the N terminal of human HNF4G. Synthetic peptide located within the following region: MDMANYSEVLDPTYTTLEFETMQILYNSSDSSAPETSMNTTDNGVNCLCA |
Rabbit Polyclonal Anti-HNF4G Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNF4G antibody: synthetic peptide directed towards the C terminal of human HNF4G. Synthetic peptide located within the following region: QDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQAS |
Rabbit Polyclonal Anti-HNF4G Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNF4G antibody: synthetic peptide directed towards the C terminal of human HNF4G. Synthetic peptide located within the following region: MSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQL |
Germany
Japan
United Kingdom
China
