Antibodies

Jump to Filters
View as table Download
DCC (Center) Rabbit Polyclonal Antibody
AP51195PU-N

USD 580.00

2 Weeks

DCC (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 642-670 amino acids from the Central region of Human DCC.
DCC Rabbit Polyclonal Antibody
TA339003

USD 539.00

5 Days

Rabbit Polyclonal Anti-DCC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCC antibody: synthetic peptide directed towards the middle region of human DCC. Synthetic peptide located within the following region: PIGQMHPPHGSVTPQKNSNLLVIIVVTVGVITVLVVVIVAVICTRRSSAQ