Antibodies

Jump to Filters
View as table Download
KCNJ1 Rabbit Polyclonal Antibody
TA338741

USD 539.00

5 Days

Rabbit Polyclonal Anti-KCNJ1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNJ1 antibody: synthetic peptide directed towards the middle region of human KCNJ1. Synthetic peptide located within the following region: LRKSLLIGSHIYGKLLKTTVTPEGETIILDQININFVVDAGNENLFFISP