Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VEGFR2 (Tyr1214) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human VEGFR2 around the phosphorylation site of Tyrosine 1214 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-TSG101 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSG101 antibody: synthetic peptide directed towards the C terminal of human TSG101. Synthetic peptide located within the following region: TIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY |
Rabbit polyclonal CHMP4C Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH derived from C terminal of Human CHMP4C. |
Rabbit polyclonal PKC zeta (Thr410) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKC? around the phosphorylation site of threonine 410 (T-S-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit polyclonal CHMP4C Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH derived from C terminal of Human CHMP4C. |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal FGFR4 (Tyr642) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human FGFR4 around the phosphorylation site of tyrosine 642. |
| Modifications | Phospho-specific |
CXCR4 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 310-360 of Human CXCR-4. |
Anti-PARD6A Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 334-346 amino acids of human par-6 partitioning defective 6 homolog alpha (C. elegans) |
Rabbit Polyclonal Anti-TGFR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TGFR2 Antibody: A synthesized peptide derived from human TGFR2 |
MET pTyr1234 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal anti-HSPA8(HSC70) antibody, Loading control
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HSPA8 |
Rabbit polyclonal KDR / VEGFR2 (Tyr1214) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human VEGFR2 around the phosphorylation site of tyrosine 1214 (F-H-YP-D-N). |
| Modifications | Phospho-specific |
Germany
Japan
United Kingdom
China
