Rabbit polyclonal anti-GAPDH antibody, Loading control
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH derived from within residues 220 - 290 of Human GAPDH. |
Rabbit polyclonal anti-GAPDH antibody, Loading control
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH derived from within residues 220 - 290 of Human GAPDH. |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse (Predicted: Feline, Chicken, Dog, Drosophila, Monkey, Pig, Rabbit, Xenopus, Zebrafish, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
USD 539.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit polyclonal anti-GAPDH antibody, Loading control
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH derived from within residues 220 - 290 of Human GAPDH. |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GAPDH (9-323) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Bovine, Canine, Drosophila, Feline, Human, Mouse, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment corresponding to a region within amino acids 9 and 323 of GAPDH |
Anti-CYP3A4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 286 amino acids of human cytochrome P450, family 3, subfamily A, polypeptide 4 |
Anti-ALDH1A1/ALDH1A2/ALDH1A3 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 290 amino acids of Human Aldehyde dehydrogenase 1 family, member A2 |
Rabbit Monoclonal Antibody against GAPDH
Applications | IHC, WB |
Reactivities | All Species |
Conjugation | Unconjugated |
Rabbit Polyclonal GAPDH Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | GAPDH antibody was raised against a 16 amino acid synthetic peptide from near the carboxy terminus of human GAPDH. |