Antibodies

Jump to Filters
View as table Download
OR52A1 Rabbit Polyclonal Antibody
TA315253

USD 380.00

In Stock

Rabbit polyclonal anti-OR52A1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR52A1.
OR52A1 (C-term) Rabbit Polyclonal Antibody
AP53075PU-N

USD 580.00

2 Weeks

OR52A1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 255-284 amino acids from the C-terminal region of human Olfactory receptor 52A1
OR52A1 Rabbit Polyclonal Antibody
TA334341

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR52A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OR52A1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR52A1. Synthetic peptide located within the following region: IQIFITVFRLPQKEARFKAFNTCIAHICVFLQFYLLAFFSFFTHRFGSHI
OR52A1 Rabbit Polyclonal Antibody
TA360384

USD 539.00

5 Days

OR52A1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human OR52A1