Antibodies

View as table Download

Rabbit Polyclonal Cytokeratin 19 Antibody

Applications FC, ICC/IF, IHC, Simple Western, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide derived from the C-terminal region of human Cytokeratin 19 (between residues 350-400) [UniProt P08727]

Rabbit Polyclonal Cytokeratin 19 Antibody

Applications ICC/IF, IHC, Simple Western, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal portion of the human Cytokeratin 19 protein (between residues 1-50) [UniProt P08727]

Rabbit polyclonal Keratin 19 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Keratin 19.

Rabbit anti Cytokeratin-19 (CK-19) Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the N-terminus of human Cytokeratin protein.

Rabbit Polyclonal Anti-KRT19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KRT19 antibody is: synthetic peptide directed towards the middle region of Human KRT19. Synthetic peptide located within the following region: DMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLR

Rabbit Polyclonal Anti-Keratin 19 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Keratin 19 Antibody: A synthesized peptide derived from human Keratin 19