Antibodies

Jump to Filters
View as table Download
COMT Rabbit Polyclonal Antibody
TA335255

USD 539.00

5 Days

Rabbit Polyclonal Anti-COMT Antibody

Applications WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-COMT antibody: synthetic peptide directed towards the middle region of human COMT. Synthetic peptide located within the following region: PDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDH
COMT Rabbit Polyclonal Antibody
TA326243

USD 380.00

2 Weeks

Rabbit polyclonal COMT antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human COMT.