Rabbit Polyclonal Anti-STAG2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human STAG2 |
Rabbit Polyclonal Anti-STAG2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human STAG2 |
Rabbit Polyclonal Anti-STAG2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-STAG2 antibody is: synthetic peptide directed towards the C-terminal region of Human STAG2. Synthetic peptide located within the following region: LLAGGDDDTMSVISGISSRGSTVRSKKSKPSTGKRKVVEGMQLSLTEESS |