Antibodies

Jump to Filters
View as table Download
Cytochrome P450 2D6 (CYP2D6) Rabbit Polyclonal Antibody
TA313725

USD 380.00

In Stock

Rabbit polyclonal Cytochrome P450 2D6 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2D6.
Cytochrome P450 2D6 (CYP2D6) Rabbit Polyclonal Antibody
TA324552

USD 580.00

5 Days

Rabbit polyclonal CYP2D6 Antibody (N-term)

Applications IHC, WB
Reactivities Human (Predicted: Rat)
Conjugation Unconjugated
Immunogen This CYP2D6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 76-105 amino acids from the N-terminal region of human CYP2D6.
Cytochrome P450 2D6 (CYP2D6) Rabbit Polyclonal Antibody
TA346157

USD 485.00

5 Days

Rabbit Polyclonal Anti-CYP2D6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2D6 antibody: synthetic peptide directed towards the N terminal of human CYP2D6. Synthetic peptide located within the following region: RPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLE
Cytochrome P450 2D6 (CYP2D6) Rabbit Polyclonal Antibody
TA313724

USD 380.00

In Stock

Rabbit polyclonal Cytochrome P450 2D6 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2D6.
Cytochrome P450 2D6 (CYP2D6) Rabbit Polyclonal Antibody
TA313726

USD 380.00

In Stock

Rabbit polyclonal anti-CYP2D6 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human CYP2D6.
Cytochrome P450 2D6 (CYP2D6) Rabbit Polyclonal Antibody
TA313728

USD 380.00

In Stock

Rabbit polyclonal anti-CYP2D6 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human CYP2D6.
Cytochrome P450 2D6 (CYP2D6) Rabbit Polyclonal Antibody
TA313727

USD 380.00

4 Weeks

Rabbit polyclonal anti-CYP2D6 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human CYP2D6.
Cytochrome P450 2D6 (CYP2D6) Rabbit Polyclonal Antibody
TA346158

USD 539.00

5 Days

Rabbit Polyclonal Anti-CYP2D6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2D6 antibody: synthetic peptide directed towards the middle region of human CYP2D6. Synthetic peptide located within the following region: EAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGV