Antibodies

Jump to Filters
View as table Download
IRF1 Rabbit Polyclonal Antibody
TA323047

USD 380.00

2 Weeks

Anti-IRF1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 220-233 amino acids of human interferon regulatory factor 1
IRF1 Rabbit Polyclonal Antibody
TA335846

USD 539.00

5 Days

Rabbit Polyclonal Anti-IRF1 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-IRF1 Antibody: synthetic peptide directed towards the N terminal of human IRF1. Synthetic peptide located within the following region: MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINK