Antibodies

Jump to Filters
View as table Download
PPP2R5A Rabbit Polyclonal Antibody
TA346501

USD 539.00

5 Days

Rabbit Polyclonal Anti-PPP2R5A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP2R5A antibody: synthetic peptide directed towards the N terminal of human PPP2R5A. Synthetic peptide located within the following region: YVSTNRGVIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASW
PPP2R5A Rabbit Polyclonal Antibody
TA314377

USD 380.00

In Stock

Rabbit polyclonal anti-PPP2R5A antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PPP2R5A.