Antibodies

View as table Download

Anti-NOTCH2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from C'13aa amino acids of human notch 2

Rabbit Polyclonal Anti-NOTCH2 (Cleaved-Ala1734) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-NOTCH2 (Cleaved-Ala1734) Antibody: A synthesized peptide derived from human NOTCH2 (Cleaved-Ala1734)

Rabbit polyclonal Notch 2 (Cleaved-Asp1733) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Notch 2.

Rabbit polyclonal anti-NOTCH 2 antibody

Applications IHC, WB
Reactivities Human, Dog, Chimpanzee
Conjugation Unconjugated
Immunogen This whole rabbit serum was prepared by repeated immunizations with a synthetic peptide corresponding to amino acid residues 2396-2409 of human Notch 2 (the total protein is 2471 aa). A residue of cysteine was added to the amino terminal end to facilitate coupling.

Rabbit polyclonal NOTCH2 (Cleaved-Ala1734) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human NOTCH2.

Rabbit Polyclonal Anti-Notch 2 (Cleaved-Asp1733) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Notch 2 (Cleaved-Asp1733) Antibody: A synthesized peptide derived from human Notch 2 (Cleaved-Asp1733)

Rabbit polyclonal NOTCH2 (Cleaved-Val1697) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human NOTCH2.

Rabbit Polyclonal Anti-NOTCH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NOTCH2 antibody: synthetic peptide directed towards the middle region of human NOTCH2. Synthetic peptide located within the following region: FPASVGKYPTPPSQHSYASSNAAERTPSHSGHLQGEHPYLTPSPESPDQW