Antibodies

Jump to Filters
View as table Download
PIM2 Rabbit Polyclonal Antibody
TA308697

USD 625.00

5 Days

Rabbit Polyclonal antibody to PIM2 (pim-2 oncogene)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 53 and 278 of PIM2 (Uniprot ID#Q9P1W9)
PIM2 Rabbit Polyclonal Antibody
TA340146

USD 539.00

5 Days

Rabbit Polyclonal Anti-PIM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIM2 antibody: synthetic peptide directed towards the middle region of human PIM2. Synthetic peptide located within the following region: LRRGCAKLIDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVW