Rabbit Polyclonal Anti-GGPS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GGPS1 antibody: synthetic peptide directed towards the middle region of human GGPS1. Synthetic peptide located within the following region: LGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSRPESTQ |
GGPS1 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 173-202 amino acids from the Central region of human GGPS1 |
Rabbit Polyclonal Anti-GGPS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GGPS1 antibody: synthetic peptide directed towards the C terminal of human GGPS1. Synthetic peptide located within the following region: LEDVGSFEYTRNTLKELEAKAYKQIDARGGNPELVALVKHLSKMFKEENE |
Germany
Japan
United Kingdom
China
