Antibodies

Jump to Filters
View as table Download
PNPO (C-term) Rabbit Polyclonal Antibody
AP53372PU-N

USD 580.00

2 Weeks

PNPO (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 232~261 amino acids from the C-terminal region of human PNPO
PNPO Rabbit Polyclonal Antibody
TA344305

USD 539.00

5 Days

Rabbit Polyclonal Anti-PNPO Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PNPO antibody: synthetic peptide directed towards the N terminal of human PNPO. Synthetic peptide located within the following region: PMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAVQCPDIGEANAMCLAT