Rabbit Polyclonal antibody to Glycerol kinase 2 (glycerol kinase 2)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Monkey, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 67 and 338 of Glycerol kinase 2 (Uniprot ID#Q14410) |
Rabbit polyclonal anti-GLPK2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GLPK2. |
Rabbit Polyclonal Anti-GK2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GK2 Antibody: synthetic peptide directed towards the N terminal of human GK2. Synthetic peptide located within the following region: DKLTGEPLYNAVVWLDLRTQTTVEDLSKKIPGNSNFVKSKTGLPLSTYFS |
Rabbit Polyclonal Anti-GK2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GK2 Antibody: synthetic peptide directed towards the C terminal of human GK2. Synthetic peptide located within the following region: QIQATESEIRYATWKKAVMKSMGWVTSQSPEGGDPSIFSSLPLGFFIVSS |
Rabbit Polyclonal Anti-GK2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GK2 Antibody: A synthesized peptide derived from human GK2 |
Germany
Japan
United Kingdom
China
