Antibodies

Jump to Filters
View as table Download
Cytochrome P450 3A4 (CYP3A4) Rabbit Polyclonal Antibody
TA324142

USD 380.00

In Stock

Anti-CYP3A4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 286 amino acids of human cytochrome P450, family 3, subfamily A, polypeptide 4
UGT (UGT1A1) Rabbit Polyclonal Antibody
TA332982

USD 365.00

2 Weeks

Rabbit anti-UGT1A1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UGT1A1
UGT (UGT1A1) Rabbit Polyclonal Antibody
TA335239

USD 539.00

5 Days

Rabbit Polyclonal Anti-UGT1A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT1A1 antibody: synthetic peptide directed towards the N terminal of human UGT1A1. Synthetic peptide located within the following region: DGSHWLSMLGAIQQLQQRGHEIVVLAPDASLYIRDGAFYTLKTYPVPFQR