Antibodies

Jump to Filters
View as table Download
HOXA10 Rabbit Polyclonal Antibody
TA330060

USD 485.00

5 Days

Rabbit Polyclonal Anti-HOXA10 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXA10 antibody: synthetic peptide directed towards the N terminal of human HOXA10. Synthetic peptide located within the following region: MSCSESPAANSFLVDSLISSGRGEAGGGGGGAGGGGGGGYYAHGGVYLPP
HOXA10 (Center) Rabbit Polyclonal Antibody
AP52073PU-N

USD 580.00

2 Weeks

HOXA10 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 234-262 amino acids from the Central region of human HOXA10