Antibodies

Jump to Filters
View as table Download
Alpha Fodrin (SPTAN1) Rabbit Polyclonal Antibody
TA344294

USD 539.00

5 Days

Rabbit Polyclonal Anti-SPTAN1 Antibody - N-terminal region

Applications IHC, IP, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SPTAN1 antibody: synthetic peptide directed towards the N terminal of human SPTAN1. Synthetic peptide located within the following region: MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ
alpha 1 Catenin (CTNNA1) Rabbit Polyclonal Antibody
TA332804

USD 450.00

3 Weeks

Rabbit anti-CTNNA1 Polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CTNNA1