Antibodies

Jump to Filters
View as table Download
PPP4C Rabbit Polyclonal Antibody
TA327274

USD 365.00

3 Weeks

PPP4C Rabbit Polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP4C
SET Rabbit Polyclonal Antibody
TA342203

USD 539.00

5 Days

Rabbit polyclonal Anti-SET Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SET antibody: synthetic peptide directed towards the N terminal of human SET. Synthetic peptide located within the following region: IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT
PP1C gamma (PPP1CC) Rabbit Polyclonal Antibody
AP05036PU-N

USD 580.00

5 Days

PP1C gamma (PPP1CC) rabbit polyclonal antibody, Purified

Applications IP, WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A KLH conjugated peptide corresponding to the C-terminal region (311-323) of PP1 gamma 1 catalytic subunit.