Antibodies

Jump to Filters
View as table Download
MMP3 Rabbit Polyclonal Antibody
AP06233PU-N

USD 465.00

3 Weeks

MMP3 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 411-460 of Human MMP-3.
MMP3 (1-35) Rabbit Polyclonal Antibody
AP23149PU-N

USD 500.00

5 Days

MMP3 rabbit polyclonal antibody, Immunoaffinity purified

Applications ICC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Carrier-protein conjugated synthetic peptide encompassing a sequence within the N-terminus region of human MMP3. The exact sequence is proprietary.
MMP3 Rabbit Polyclonal Antibody
TA384788

USD 380.00

4 Weeks

MMP3 Rabbit polyclonal Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human MMP-3. AA range:421-470
MMP3 Rabbit Polyclonal Antibody
TA336495

USD 550.00

5 Days

Rabbit Polyclonal MMP-3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an C-terminal portion of the human MMP3 protein (between residues 400-477) [UniProt P08254]
MMP3 Rabbit Polyclonal Antibody
TA346323

USD 539.00

5 Days

Rabbit Polyclonal Anti-MMP3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MMP3 antibody: synthetic peptide directed towards the middle region of human MMP3. Synthetic peptide located within the following region: SFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTN
MMP3 Rabbit Polyclonal Antibody
TA346324

USD 539.00

5 Days

Rabbit Polyclonal Anti-MMP3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MMP3 antibody: synthetic peptide directed towards the middle region of human MMP3. Synthetic peptide located within the following region: AEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLN
MMP3 Rabbit Polyclonal Antibody
TA384789

USD 380.00

4 Weeks

MMP3 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human MMP3
MMP3 Rabbit Polyclonal Antibody
TA313102

USD 380.00

4 Weeks

Rabbit polyclonal anti-MMP-3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human MMP-3.
MMP3 Rabbit Polyclonal Antibody
TA323014

USD 380.00

In Stock

Anti-MMP3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 350 amino acids of Human Matrix metalloproteinase-3
MMP3 Rabbit Polyclonal Antibody
TA326993

USD 365.00

2 Weeks

MMP3 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MMP3
MMP3 Rabbit Polyclonal Antibody
AP13184PU-N

USD 580.00

2 Weeks

MMP3 rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the center region of human MMP3.
MMP3 Rabbit Monoclonal Antibody [Clone ID: R04-8G6]
TA384790

USD 380.00

4 Weeks

MMP3 Rabbit monoclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated