Antibodies

Jump to Filters
View as table Download
Oligodendrocyte Specific Protein (CLDN11) Rabbit Polyclonal Antibody
TA351083

USD 380.00

In Stock

Rabbit Polyclonal Anti-CLDN11 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLDN11
Oligodendrocyte Specific Protein (CLDN11) Rabbit Polyclonal Antibody
TA334203

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-CLDN11 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN11 antibody: synthetic peptide directed towards the C terminal of human CLDN11. Synthetic peptide located within the following region: VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH
Oligodendrocyte Specific Protein (CLDN11) (C-term) Rabbit Polyclonal Antibody
AP31210PU-N

USD 575.00

2 Weeks

Oligodendrocyte Specific Protein (CLDN11) (C-term) rabbit polyclonal antibody, Purified

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide from C-terminal of human claudin 11 protein